PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang07g06820.1
Common NameLR48_Vigan401s004600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 81aa    MW: 9365.51 Da    PI: 6.5164
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang07g06820.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.33.1e-072261445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++++E++l+ +  k+ G + W++Ia +++ gR ++++  +w 
   Vang07g06820.1 22 MSEQEEDLIHRMYKLVGDK-WNLIAGRIP-GRKAEEIERFWI 61
                     589**************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001679.23E-52260No hitNo description
SuperFamilySSF466895.46E-72361IPR009057Homeodomain-like
PfamPF002491.6E-62361IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-102361IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MSTTATTTSE EVSSNEWEVI HMSEQEEDLI HRMYKLVGDK WNLIAGRIPG RKAEEIERFW  60
IMRHTHTFSV TKNQSKAKDS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2381151e-63KP238115.1 Lablab purpureus caprice (cpc) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520493.16e-53PREDICTED: MYB-like transcription factor ETC3
SwissprotQ8GV055e-30TRY_ARATH; Transcription factor TRY
TrEMBLA0A0L9T9U31e-53A0A0L9T9U3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T6711e-53A0A0S3T671_PHAAN; Uncharacterized protein
STRINGGLYMA01G43435.11e-40(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35832757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.12e-24MYB_related family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]